PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10036103
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 479aa    MW: 52427.6 Da    PI: 5.2172
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10036103genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.71.1e-173077148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT  Ed +lv++v+++G g+W+++ ++ g+ R++k+c++rw ++l
      Lus10036103 30 KGPWTSGEDAILVEYVTKHGEGNWNAVQKHSGLSRCGKSCRLRWANHL 77
                     79******************************************9986 PP

2Myb_DNA-binding521.6e-1683126146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T++E+ l++++++++G++ W++ a++m+ gRt++++k++w++
      Lus10036103  83 KGAFTPDEERLIIELHAKMGNK-WARMAAEMP-GRTDNEIKNYWNT 126
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.9022577IPR017930Myb domain
SuperFamilySSF466892.28E-3028124IPR009057Homeodomain-like
SMARTSM007173.5E-142979IPR001005SANT/Myb domain
PfamPF002496.2E-153077IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-233184IPR009057Homeodomain-like
CDDcd001671.84E-103277No hitNo description
PROSITE profilePS5129425.68978132IPR017930Myb domain
SMARTSM007172.8E-1682130IPR001005SANT/Myb domain
PfamPF002491.5E-1583126IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.3E-2585130IPR009057Homeodomain-like
CDDcd001672.34E-1285126No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 479 aa     Download sequence    Send to blast
MPNGSEEKKR SKGRRDSTAG IEQGSSALKK GPWTSGEDAI LVEYVTKHGE GNWNAVQKHS  60
GLSRCGKSCR LRWANHLRPD LRKGAFTPDE ERLIIELHAK MGNKWARMAA EMPGRTDNEI  120
KNYWNTRIKR LQRAGLPIYP PEVCSKIRDG SQESMGTDSN ADGLPDPAQN HHREIPELNF  180
KNLKINRGVL SYLPNLLDVP ASSFLKQGLG SSNDYGFMLP TLPPPPKRLR ADSILPGVDG  240
SAVSSGFPPY CQFPDYACES IPEHFGCLTS PYDSDVNTYD DQPPMAVLPG SHALLNDDSS  300
SSEPISRAMK LELPSLQYTE TQQLDSWGMS SSPLLSADSV DNLIQSPPTE SDCFSPRSSG  360
LLEAVLYESK MLGNMNWSSV APEDMMNHPP QPLNSRKRDL EVQTDPNSPL GHPAASVFNA  420
STPMSGSSLD EPGYEMKQEM ASQVSTPCVE DNDGSSCRHI DFSRPDVLLG LGSYFGLS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-32241301106B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012075987.10.0PREDICTED: transcription factor GAMYB-like
TrEMBLA0A067KE640.0A0A067KE64_JATCU; MYB family protein
STRINGPOPTR_0009s02380.11e-167(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11440.12e-95myb domain protein 65